IGF-1 DES
IGF-1 DES is a truncated IGF-1 (des 1–3) analog with reduced affinity for IGF binding proteins.
$0.00
- CAS number
- 112603-35-7
- Form
- Lyophilized powder
- Purity
- ≥99% (HPLC)
- Storage
- −20 °C, dry and protected from light
- Independently lab-tested — every batch, before sale. Request this batch’s COA
- Ships from Franklin Square, NY — free UPS on US orders over $200
- Secure checkout — Visa, Mastercard, AMEX, Discover, bank transfer
We added you to this product's waitlist and we'll send you an email when the product is available.
Leave WaitlistThis product is currently sold out.
No worries! Enter your email, and we'll let you know as soon as it's back in stock.
-
3rd Party CoA
-
Quality guaranteed
-
Shipped within 24 hours
-
99% Purified
IGF-1 DES is a truncated IGF-1 (des 1–3) analog with reduced affinity for IGF binding proteins.
- CAS number: 112603-35-7
- Molecular formula: C319H501N91O96S7
- Molecular weight: 7371.5 g/mol
- Amino acid sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (three disulfide bonds)
- Peptide length: 67 amino acids
- Form: Lyophilized powder
- Contents: 1 mg per vial
- Purity: ≥99% (HPLC)
- Identity: Confirmed by mass spectrometry
- Batch/lot number: Printed on the vial label and on the matching Certificate of Analysis
- Certificate of Analysis: Request the COA for your batch
IGF-1 DES is referenced in in-vitro and analytical laboratory work in the following areas:
- IGF-1 receptor activation assays
- IGFBP interaction
- Cell proliferation assays
Store sealed lyophilized material at −20 °C, dry and protected from light. Handle according to your institution’s laboratory safety procedures.
For laboratory research use only. Not for human or veterinary use, and not for diagnostic or therapeutic use. Sold only to qualified researchers aged 21 or older.
IGF-1 DES is a truncated IGF-1 (des 1–3) analog with reduced affinity for IGF binding proteins.
A lyophilized (freeze-dried) powder in a sealed vial. Contents: 1 mg per vial.
112603-35-7
Each batch is tested by HPLC (≥99% purity) and its identity is confirmed by mass spectrometry. Results are recorded on the batch Certificate of Analysis.
Use the request form on our Lab Test Results page and include the batch/lot number printed on your vial.
Store sealed material at −20 °C, dry and protected from light.
Yes. For laboratory research use only. Not for human or veterinary use, and not for diagnostic or therapeutic use. Sold only to qualified researchers aged 21 or older.
When will my order ship?
Orders placed by 2pm ET, Monday–Friday, ship the same day via UPS. Later orders ship the next business day.
Is shipping free?
Free UPS shipping on US orders over $200.
How do I get the Certificate of Analysis?
Request it here and we email the certificate for your batch the same business day.
Is the price per vial?
Yes. Each size is one vial of lyophilized powder. Order 3 or more of the same size for 5% off, or 5 or more for 10% off.
RELATED PRODUCTS
CJC-1295 DAC
Restocking
Next batch is in testing. We only sell a batch once its lab results are back.
Get a restock alert
SPD-Tesa
$29.99
PEG-MGF (Mechano Growth Factor)
$144.99
IGF-1 LR3
$200.00
GHRP-6
$34.99
