FOXO4-DRI

FOXO4-DRI is a D-retro-inverso peptide that interferes with FOXO4–p53 binding.

$289.99

CAS number: 2460055-10-9
Form: Lyophilized powder
Purity: ≥99% (HPLC)
Storage: −20 °C, dry and protected from light

Select Mg

Restocking. The next batch is in testing, and we only sell a batch once its lab results are back. Join the list below and we’ll email you the day it’s back.

Quantity · save more per vial

Multi-vial pricing applies automatically in your cart. It doesn’t combine with coupon codes.

Independently lab-tested — every batch, before sale. Request this batch’s COA
Ships from Franklin Square, NY — free UPS on US orders over $200
Secure checkout — Visa, Mastercard, AMEX, Discover, bank transfer

Questions about this batch? Real people reply the same business day.Message us

SKU: 214412-1-1-5-1-4-1-2-2-1-8 Category: Molecular & Cellular Research

3rd Party CoA
Quality guaranteed

Shipped within 24 hours
99% Purified

Overview

FOXO4-DRI is a D-retro-inverso peptide that interferes with FOXO4–p53 binding.

Compound Data

CAS number: 2460055-10-9
Molecular formula: C₂₂₈H₃₈₈N₈₆O₆₄
Molecular weight: 5358.1 g/mol
Amino acid sequence: All-D-amino-acid retro-inverso peptide: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
Peptide length: 46 amino acids
Form: Lyophilized powder
Contents: 10 mg per vial
Purity: ≥99% (HPLC)
Identity: Confirmed by mass spectrometry
Batch/lot number: Printed on the vial label and on the matching Certificate of Analysis
Certificate of Analysis: Request the COA for your batch

Research Context

FOXO4-DRI is referenced in in-vitro and analytical laboratory work in the following areas:

FOXO4–p53 interaction
Senescent-cell biology in vitro
Apoptosis signaling

Storage & Handling

Store sealed lyophilized material at −20 °C, dry and protected from light. Handle according to your institution’s laboratory safety procedures.

Compliance Notice

For laboratory research use only. Not for human or veterinary use, and not for diagnostic or therapeutic use. Sold only to qualified researchers aged 21 or older.

What is FOXO4-DRI?

FOXO4-DRI is a D-retro-inverso peptide that interferes with FOXO4–p53 binding.

What form is FOXO4-DRI supplied in?

A lyophilized (freeze-dried) powder in a sealed vial. Contents: 10 mg per vial.

What is the CAS number for FOXO4-DRI?

2460055-10-9

How is purity verified?

Each batch is tested by HPLC (≥99% purity) and its identity is confirmed by mass spectrometry. Results are recorded on the batch Certificate of Analysis.

How do I get the Certificate of Analysis for my batch?

Use the request form on our Lab Test Results page and include the batch/lot number printed on your vial.

How should FOXO4-DRI be stored?

Store sealed material at −20 °C, dry and protected from light.

Is FOXO4-DRI for laboratory research only?

Yes. For laboratory research use only. Not for human or veterinary use, and not for diagnostic or therapeutic use. Sold only to qualified researchers aged 21 or older.

When will my order ship?
Orders placed by 2pm ET, Monday–Friday, ship the same day via UPS. Later orders ship the next business day.

Is shipping free?
Free UPS shipping on US orders over $200.

How do I get the Certificate of Analysis?
Request it here and we email the certificate for your batch the same business day.

Is the price per vial?
Yes. Each size is one vial of lyophilized powder. Order 3 or more of the same size for 5% off, or 5 or more for 10% off.