Overview

IGF-1 DES is a truncated IGF-1 (des 1–3) analog with reduced affinity for IGF binding proteins.

Molecular Identity

  • CAS number: 112603-35-7
  • Molecular formula: C319H501N91O96S7
  • Molecular weight: 7371.5 g/mol
  • Amino acid sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (three disulfide bonds)
  • Peptide length: 67 amino acids
  • Supplied form: Lyophilized powder
  • Catalog contents: 1 mg per vial

Laboratory Research Context

In laboratory settings, IGF-1 DES is used as a reference material in analytical, biochemical and in-vitro work, including:

  • IGF-1 receptor activation assays
  • IGFBP interaction
  • Cell proliferation assays

Analytical Quality

Each batch is tested by HPLC (≥99% purity) with identity confirmed by mass spectrometry. Batch results are recorded on the Certificate of Analysis, available from our Lab Test Results page.

Catalog Listing

View IGF-1 DES in the catalog

Educational Disclaimer

This page describes molecular identity and in-vitro laboratory research context only. It makes no claims about effects in humans or animals and is not medical advice. All products are sold for laboratory research use only and are not for human or veterinary use, or for diagnostic or therapeutic use.