LL-37 – Research Overview

Overview

LL-37 is a 37-amino-acid cationic peptide from the C-terminus of human cathelicidin (hCAP18).

Molecular Identity

• CAS number: 154947-66-7
• Molecular formula: C₂₀₅H₃₄₀N₆₀O₅₃
• Molecular weight: 4493.3 g/mol
• Amino acid sequence: [LL-37, 37 aa]
• Peptide length: 37 amino acids
• Supplied form: Lyophilized powder
• Catalog contents: 10 mg per vial

Laboratory Research Context

In laboratory settings, LL-37 is used as a reference material in analytical, biochemical and in-vitro work, including:

• Membrane interaction and antimicrobial assays
• Toll-like receptor modulation
• Host-defense peptide structure

Analytical Quality

Each batch is tested by HPLC (≥99% purity) with identity confirmed by mass spectrometry. Batch results are recorded on the Certificate of Analysis, available from our Lab Test Results page.

Catalog Listing

View LL-37 in the catalog

Educational Disclaimer

This page describes molecular identity and in-vitro laboratory research context only. It makes no claims about effects in humans or animals and is not medical advice. All products are sold for laboratory research use only and are not for human or veterinary use, or for diagnostic or therapeutic use.