SPD-CAG – Research Overview

Overview

SPD-CAG is a long-acting, acylated amylin analog that acts at amylin and calcitonin receptors.

Molecular Identity

• CAS number: 1415456-99-3
• Molecular formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
• Molecular weight: 4409.1 g/mol
• Amino acid sequence: (19-carboxynonadecanoyl-γGlu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (disulfide bridge Cys2–Cys7)
• Peptide length: 37 amino acids
• Supplied form: Lyophilized powder
• Catalog contents: 5 mg or 10 mg per vial

Laboratory Research Context

In laboratory settings, SPD-CAG is used as a reference material in analytical, biochemical and in-vitro work, including:

• Amylin and calcitonin receptor binding
• Receptor heterodimer signaling
• Peptide stability studies

Analytical Quality

Each batch is tested by HPLC (≥99% purity) with identity confirmed by mass spectrometry. Batch results are recorded on the Certificate of Analysis, available from our Lab Test Results page.

Catalog Listing

View SPD-CAG in the catalog

Educational Disclaimer

This page describes molecular identity and in-vitro laboratory research context only. It makes no claims about effects in humans or animals and is not medical advice. All products are sold for laboratory research use only and are not for human or veterinary use, or for diagnostic or therapeutic use.